General Information

  • ID:  hor006109
  • Uniprot ID:  P06307
  • Protein name:  Cholecystokinin-25
  • Gene name:  CCK
  • Organism:  Homo sapiens (Human)
  • Family:  Gastrin/cholecystokinin family
  • Source:  Human
  • Expression:  NA
  • Disease:  Diseases associated with CCK include Cholecystitis and Biliary Dyskinesia.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding; GO:0051428 peptide hormone receptor binding
  • GO BP:  GO:0001764 neuron migration; GO:0007165 signal transduction; GO:0007409 axonogenesis; GO:0007586 digestion; GO:0042755 eating behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030424 axon

Sequence Information

  • Sequence:  IVKNLQNLDPSHRISDRDYMGWMDF
  • Length:  25(79-103)
  • Propeptide:  MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
  • Signal peptide:  MNSGVCLCVLMAVLAAGALT
  • Modification:  T19 Sulfotyrosine;T25 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  19-19Y->F: Reduces the quantity of secreted CCK8 by 50%.

Activity

  • Function:  This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  CCKBR, CCKAR
  • Target Unid:   P32239, P32238
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P06307-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006109_AF2.pdbhor006109_ESM.pdb

Physical Information

Mass: 347972 Formula: C134H204N38O40S2
Absent amino acids: ACET Common amino acids: D
pI: 5.54 Basic residues: 4
Polar residues: 6 Hydrophobic residues: 7
Hydrophobicity: -76 Boman Index: -6602
Half-Life / Aliphatic Index: 20 hour Aliphatic Index: 74
Instability Index: 5174.8 Extinction Coefficient cystines: 6990
Absorbance 280nm: 291.25

Literature

  • PubMed ID:  3856870
  • Title:  Molecular cloning of the human cholecystokinin gene by use of a synthetic probe containing deoxyinosine.
  • PubMed ID:  15489334
  • Title:  The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  • PubMed ID:  9371719
  • Title:  Cleavage of arginyl-arginine and lysyl-
  • PubMed ID:  10336644
  • Title:  
  • PubMed ID:  11076522
  • Title: